PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001123.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 78aa    MW: 9046.57 Da    PI: 4.7231
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001123.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM514.8e-161964248
                      NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             ppGfrF+Ptdeel v+yLk+k+ ++++ l +vi e+d+yk eP++Lp
  Itr_sc001123.1_g00001.1 19 PPGFRFQPTDEELAVYYLKRKICRRPIML-DVIGETDVYKREPEELP 64
                             9*************************999.99**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-181568IPR003441NAC domain
PROSITE profilePS5100518.1381878IPR003441NAC domain
PfamPF023659.3E-81966IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MELTSEPSSC SCLCGQRFPP GFRFQPTDEE LAVYYLKRKI CRRPIMLDVI GETDVYKREP  60
EELPGIAFFS LPIYQLLL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237849.17e-22PREDICTED: uncharacterized protein LOC101260636
SwissprotQ9XIC54e-20NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A068TZ023e-22A0A068TZ02_COFCA; Uncharacterized protein
STRINGSolyc04g072220.2.12e-21(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.12e-21NAC domain containing protein 17